Feruloyl esterase B (gene fae-1) from Neurospora crassa

Enzyme Description

Species

Extremophile

EC Number

3.1.1.73 ↗

Sequence

Length: 292 amino acids

MLPRTLLGLALTAATGLCASLQQVTNWGSNPTNIRMYTYVPDKLATKPAIIVALHGCGGTAPSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPASLTHGAGGDSLGIVAMVNYTIAKYNADASRVYVMGTSSGGMMTNVMAATYPEVFEAGAAYSGVAHACFAGAASATPFSPNQTCARGLQHTPEEWGNFVRNSYPGYTGRRPRMQIYHGLADNLVYPRCAMEALKQWSNVLGVEFSRNVSGVPSQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN

Craig B. Faulds et al. (2011) — Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases

Bioresource Technology · doi:10.1016/j.biortech.2011.01.088 ↗ · Activity - Classical Stability - C50 Stability - Incubation Activity + Stability - Incubation

62 measurements ▼

Database ID

UniProt: Q9HGR3 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host yeast Pichia pastoris

Experimental Data (62 measurements)

62 measurements — page 2 of 4

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	100.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	99.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	85.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	62.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	18.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	25.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	89.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	48.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	33.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	23.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	17.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	4.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	1%	100.0	81.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	97.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	16.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	1%	100.0	66.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid , Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	75.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	68.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol , p-Coumaric acid	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	20%	100.0	56.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	84.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	88.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	111.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	66.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	41.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	34.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	1%	100.0	104.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	85.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	74.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	69.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	69.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	100.0	40.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	30%	100.0	16.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	132.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	142.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	130.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	134.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	100.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	99.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	85.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	35%	100.0	62.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	18.0	%	100 mM MOPS	6	37°C	1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	5%	100.0	25.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	89.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	48.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	15%	100.0	33.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	23.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	100.0	17.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	4.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	1%	100.0	81.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	97.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	100.0	16.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	1%	100.0	66.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	75.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	1%	100.0	68.0	%	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	30%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	25%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	20%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	15%	100.0	5.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	10%	100.0	12.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	5%	100.0	26.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	15%	100.0	11.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	25%	100.0	0.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	20%	100.0	5.0	%	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Classical aqueous control (in %)
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	4.66	3.48	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	4.66	3.29	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	42.12	28.88	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	42.12	23.31	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in aqueous phase
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	—	—	22.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	1,4-Dioxane	—	—	3.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	—	—	4.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	34.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Not applicable control (in % (v/v))
Stability - C50	Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	10.0	% (v/v)	100 mM MOPS	6	37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Not applicable control (in % (v/v))
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	4.41	3.48	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	4.35	3.29	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl ferulate	Ferulic acid, Methanol	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	36.7	28.88	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation	Activity after incubation (96 hours at 37°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent	Acetone	10%	39.4	23.31	U/mg	Incubation: 100 mM MOPS, Assay: 100 mM MOPS	Incubation: 6, Assay: 6	Incubation: 37°C, Assay: 37°C	60 µM Methyl p-coumarate	Methanol, p-Coumaric acid	—	—	Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent \| Clear about assay in the presence of organic solvent and control in the presence of organic solvent

‹ Prev

1 2 3 4

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — C₅₀

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Feruloyl esterase B (gene fae-1) from Neurospora crassa

Enzyme Description

Sequence

Experimental Data (62 measurements)

Visualization : Activity — Classical

Visualization : Stability — Incubation

Visualization : Activity + Stability — Incubation

Visualization : Stability — C50

Structure

Loading…

Visualization : Stability — C₅₀