Lipase from Staphylococcus epidermidis AT2

Enzyme Description

Species
Staphylococcus epidermidis AT2 β†—
Extremophile
No but "organic-solvent tolerant" and "cold-adapted" enzyme
EC Number
3.1.1.3 β†—

Sequences

Used in: Raja Noor Zaliha Raja Abd. Rahman et al. (2010)

Length: 643 amino acids
MKNNNETRRFSIRKYTVGVVSIITGITIFVSGQHAQAAEMTQSSSDFNEQSQQTEQVEHKEDTTHLSYELNQEGDTASQSKTNQENQSDENVQKKNNQTQQDSTQTSPLNDQEQTLKGQQSKDNHVTPNSRQDTYPKGQNQDDKGKQQFKDNQHSQTEHQPNTQNQNNDQDSSDKKQHPSDQTQAPSSKGTQPKQSQSIGDRDKTVKQPSSKVHKIGNTKTDKTVKTNQKKQTSLTSPRVVKSKQTKHINQLTAQAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQELTKLGYRVHEANVGAFSSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKKIHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMVSTITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQWGFKQKPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPNIVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRAIGGDDNKNVRVNDGIVPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTDYKRTGEELGQFYMSMINNMLKVEELDGITRK

Used in: Nor Hafizah Ahmad Kamarudin et al. (2014), Nor Hafizah Ahmad Kamarudin et al. (2014)

Length: 390 amino acids
AQAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQELTKLGYRVHEANVGAFSSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKKIHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMVSTITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQWGFKQKPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPNIVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRAIGGDDNKNVRVNDGIVPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTDYKRTGEELGQFYMSMINNMLKVEELDGITRK
Raja Noor Zaliha Raja Abd. Rahman et al. (2010) β€” Expression of an Organic Solvent Stable Lipase from Staphylococcus epidermidis AT2
International Journal of Molecular Sciences  Β· doi:10.3390/ijms11093195 β†—  Β· Activity + Stability - Incubation
14 measurements ▼
Database ID
UniProt: B5A5A8 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli TOP10

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 100.0 112.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Methanol 25% 100.0 1.2 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Acetonitrile 25% 100.0 0.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Ethanol 25% 100.0 0.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Acetone 25% 100.0 0.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Diethyl Ether 25% 100.0 0.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Ethyl Acetate 25% 100.0 15.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Chloroform 25% 100.0 14.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Benzene 25% 100.0 56.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Toluene 25% 100.0 230.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent 1-Octanol 25% 100.0 295.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent Ethylbenzene 25% 100.0 58.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent p-Xylene 25% 100.0 190.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (30 minutes at 37Β°C) measured by absorbance spectrophotometry (colorimetric Kwon-Rhee assay, absorbance measurement of the free fatty acid reacting with cupric acetate–pyridine reagent product, 715 nm) in the presence of organic solvent n-Hexane 25% 100.0 154.0 % Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer Incubation: 7, Assay: 7 Incubation: 37Β°C, Assay: 37Β°C ? mM Olive oil free fatty acids , glycerol β€” Incubation: 150 rpm, Assay: 200 rpm Water-incubated control (in %) | High uncertainty about whether residual activity assay was with or without organic solvent

Visualization : Activity + Stability β€” Incubation

Raja Noor Zaliha Raja Abd. Rahman et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Nor Hafizah Ahmad Kamarudin et al. (2014) β€” Unscrambling the Effect of C-Terminal Tail Deletion on the Stability of a Cold-Adapted, Organic Solvent Stable Lipase from Staphylococcus epidermidis AT2
Molecular Biotechnology  Β· doi:10.1007/s12033-014-9753-1 β†—  Β· Stability - Incubation
30 measurements ▼
Nor Hafizah Ahmad Kamarudin et al. (2014) β€” A New Cold-Adapted, Organic Solvent Stable Lipase from Mesophilic Staphylococcus epidermidis AT2
The Protein Journal  Β· doi:10.1007/s10930-014-9560-3 β†—  Β· Stability - Incubation
15 measurements ▼

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*