Carboxylesterase (gene BioHs) from Serratia sp. SES-01

Enzyme Description

Species

Extremophile

EC Number

3.1.1.85 ↗

Sequence

Length: 258 amino acids

MSALYWQTIGEGDRDLVLLHGWGLNAEVWHCMIERLTPHFRLHLVDLPGYGRSLGFGPMSLEQMAETVMAAAPAKAWWLGWSLGGLVASQIALLQPQRVSGLITVASSPCFAAQDDWPGIRPEVLSGFQHQLGQDFQRTVERFLALQTLGTQSARQDARLLKSVVLNQPMPSVEVLNGGLEILRTADLRQPLAKLPLPLLRVYGYLDGLVPRKVAGLLDVSWPNSPSIIIAKAAHAPFISQPDEFAEIIGTFVAENGI

Jae Kwang Song et al. (2009) — Gene Cloning, Expression, and Characterization of a New Carboxylesterase from Serratia sp. SES-01: Comparison with Escherichia coli BioHe Enzyme

Journal of Microbiology and Biotechnology · doi:10.4014/jmb.0804.287 ↗ · Activity + Stability - Incubation

21 measurements ▼

Database ID

UniProt: B0M0H6 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli BL21 JM109

Experimental Data (21 measurements)

21 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	10%	100	92	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent

Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	20%	100	14	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	76	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	30%	100	4	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	30%	100	3	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	30%	100	5	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	30%	100	4	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	30%	100	5	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	30%	100	2	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	90	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	20%	100	31	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	20%	100	19	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	10%	100	93	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	20%	100	25	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	20%	100	41	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Methanol	20%	100	71	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	93	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetone	10%	100	88	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Acetonitrile	10%	100	66	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	1-Butanol	10%	100	27	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Isopropanol	10%	100	84	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent
Activity + Stability - Incubation	Activity after incubation (30 minutes at 20°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent	Ethanol	10%	100	92	%	Incubation: 50 mM phosphate buffer, Assay: 40 mM Tris-HCl, 12 mM phosphate buffer, 0.8% acetonitrile and 3.2% Ethanol	Incubation: ?, Assay: 8.5	Incubation: 20°C, Assay: 45°C	0.1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity, activity measured in the presence of organic solvent

‹ Prev

1 2

Next ›

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*